PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02756.1.p
Common NameEUGRSUZ_F02756, LOC104449642
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 370aa    MW: 42008 Da    PI: 9.551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02756.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-1859104147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
  Eucgr.F02756.1.p  59 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 104
                       899*****************************.***********996 PP

2Myb_DNA-binding59.19.9e-19111154146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r ++T+eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
  Eucgr.F02756.1.p 111 RRPFTEEEEERLLAAHRVHGNK-WALIARLFP-GRTDNAVKNHWHV 154
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.37254105IPR017930Myb domain
SuperFamilySSF466891.2E-2958152IPR009057Homeodomain-like
SMARTSM007178.4E-1558107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2760112IPR009057Homeodomain-like
PfamPF139212.9E-1762122No hitNo description
CDDcd001674.50E-1462103No hitNo description
PROSITE profilePS5129428.249106160IPR017930Myb domain
SMARTSM007176.4E-16110158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21113159IPR009057Homeodomain-like
CDDcd001671.84E-7122153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MIIHIFHFLY ILLITKPGIY FDLASDVEEF PFGHAIMDSS GRANSGSGDD GKSAAACPRG  60
HWRPAEDEKL RQLVEQYGAQ NWNSIAEKLQ GRSGKSCRLR WFNQLDPRIN RRPFTEEEEE  120
RLLAAHRVHG NKWALIARLF PGRTDNAVKN HWHVIMARKQ REQSKLCGKR IHQEYSLGDP  180
TGLQGRKTHF QDELLGSQFR FDQGKGFFIF QSPGKERNFA LPSSSSASWT FGSQSLAKSA  240
HNSSSVDDLN RIERRDYYNR ASNNYSGREG ARSLSQPFHS HPYSSLSSAY SISQYQRVVP  300
SPFGYVCLGD GCNDSNTMKK QEIVSFHDEM PRLEKTRLHV NSTHQERADK SLKHKDVPFI  360
DFLGVGISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-33591597107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02756.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062174.10.0PREDICTED: myb-like protein Q
TrEMBLA0A059BTH10.0A0A059BTH1_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s20870.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16592913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-62myb domain protein 52